PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00984g00245.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 436aa    MW: 47852.3 Da    PI: 7.1657
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00984g00245.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32243298156
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                               k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Peaxi162Scf00984g00245.1 243 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 298
                               68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.22240300IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-28241301IPR009057Homeodomain-like
SuperFamilySSF466891.79E-16241301IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26243298IPR006447Myb domain, plants
PfamPF002497.5E-7245296IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MMSSPSELSL ECKPHSYSML LKSFGEKLTD QTQNLEEFLA RLEEERLKID AFKRELPLCM  60
QLLTNAMEAS RQQLQSYREK SQGPRPVLEE FIPLKINAST EGAEKVANTA DNKANWMTSA  120
QLWSPGSEET KEKSTLTTSK ETDMGFSKIA LDNKEIKNGG AFIPFTKDNN SCLSPTVLAL  180
APSNNKQNEM VEDNKNLETI MNYSAKANSP ISEQGKLGGS SSQPADSQSN GAATNNSTQP  240
HRKARRCWSP DLHRRFVNAL QMLGGSQVAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR  300
RPSPSPQAAG TAAPHLVVLG GIWVPPEYAT AAAHGGAPPT ATLYGPHPTS HAPSPHYITT  360
PQAVAHQEYY TPQPLQSLHH LQHQQLYHHG HMYNTNNNKP PASNSLTHSQ PESDVGGSGQ  420
GDRSESIEDG KSESSS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009630682.10.0PREDICTED: transcription factor LUX
TrEMBLK4DBL71e-174K4DBL7_SOLLC; Uncharacterized protein
STRINGSolyc12g006800.1.11e-173(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87942229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-97G2-like family protein